PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 294aa    MW: 32351.2 Da    PI: 5.8684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024978.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l  ++k +G g W++ +++ g++R++k+c++rw++yl
      Pbr024978.1 14 RGAWTALEDKILSSYIKTHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding491.4e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
      Pbr024978.1  67 RGNISGDEEELIVRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      6777889***************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.891961IPR017930Myb domain
SuperFamilySSF466894.69E-2712108IPR009057Homeodomain-like
SMARTSM007173.4E-121363IPR001005SANT/Myb domain
PfamPF002494.9E-141461IPR001005SANT/Myb domain
CDDcd001674.53E-91661No hitNo description
PROSITE profilePS5129423.44962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2365115IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.0E-1367111IPR001005SANT/Myb domain
CDDcd001671.09E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAL EDKILSSYIK THGEGKWRSL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SGDEEELIVR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKKSKVDS  120
FSRSSKETSL NPSKSVAKKK DVESKTSTAA AQPIVIRTKA TRLTKILVPQ NIPSDENSTA  180
AAANPLELQA HQTQSAEKGG STEESPRTNA GDCSNILKNF GCDDDEIDAK EDQYCNEFQL  240
LDSIPLDEAM INDGCWTGGN GCDLEDYGAS LDLDSLAFLL DSEDWPSQEN VIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT6011230.0KT601123.1 Pyrus x bretschneideri cultivar Red Zaosu TT2-like transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334686.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0U3J8Y20.0A0A0U3J8Y2_9R
STRINGVIT_04s0008g01800.t011e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.16e-63MYB family protein
Publications ? help Back to Top
  1. Zhai R, et al.
    Two MYB transcription factors regulate flavonoid biosynthesis in pear fruit (Pyrus bretschneideri Rehd.).
    J. Exp. Bot., 2016. 67(5): p. 1275-84
    [PMID:26687179]